Wednesday, September 2, 2009

Slim Fast

The Slim Fast diet... hmmm. As I started this review, I spent some time searching for something -- anything -- positive to say about this diet. The only thing I could come up with is that the Slim Fast diet plan is mind-numbingly easy to follow. A healthy shake for breakfast, one for lunch, and a healthy dinner, and a couple of small snacks in between - doesn't get much easier than that, does it? Nonetheless, the Slim Fast diet pretty much encapsulates what's wrong with the state of mainstream dieting and weight loss today.

OK, OK... I hear you asking, "What's wrong with a healthy shake for breakfast and lunch, and a sensible dinner in the evening?"

Got a minute? Good! Let me begin with the "healthy" shakes...

Since the time of my original review, SlimFast has expanded its product line. It now offers Optima, High Protein and Low Carb variations of the shake, plus the original discussed here, of course. These have somewhat reduced sugar and a little more fiber (4 - 5 grams).

Ironically, the "low carb" shakes have more protein (20 g) than the "high protein" ones (15 g).


Healthy, in this case, is relative. If your idea of good nutrition is combining a bag of pork rinds with a couple of burgers from the local fast food joint, well then yes, these are nutritious shakes.

In reality... the Slim Fast shakes aren't particularly nutritious, and they certainly aren't worth the money you pay for them.

So what's in a Slim Fast diet shake?

The 4 main ingredients are skim milk, sugar, fructose, and cocoa. In other words, milk, sugar, and sugar. Other ingredients include various vegetable oils, emulsifiers, and a dubious vitamin blend.

A 375ml (1.5 cups) shake contains 12 grams of protein -- slightly less than what you'd obtain drinking the same amount of 1% low-fat milk.

This same shake contains 38 grams of carbohydrates -- 20 grams more than if you drank the equivalent amount of 1% low-fat milk (with those additional carbs coming from the added sugar). Considering that milk contains significant amounts of vitamins A and D, Riboflavin, Niacin, Vitamin B12, Calcium, Phosphorous, Magnesium and Zinc, I'd suggest that you chuck the Slim Fast shakes (vitamin blend and all), and simply drink milk instead.

OK... that's problem number 1 -- the shakes are little more than an expensive, sugar-laden milk supplement.

What's wrong with the Slim Fast diet?

The daily caloric limit is set so low as to be detrimental to any long term weight loss success (each shake contains 240 calories (at least the one I'm holding in my hand does). Couple two with a normal dinner consisting of a chicken breast, baked potato and vegetable, add a snack or two a day and you're looking at anywhere between 1000 - 1200 calories per day).

At first, it may seem logical that drastically reducing calories would be the key to successful weight loss -- and it's true, you must reduce your calories to lose weight. However when you reduce calories too much, you've got a problem. And it's this problem that is the Slim Fast diet plan's biggest drawback...

43 comments:

Acai Berry Side Effects said...

One big difficulty with the slim fast diet is that it is not easy to get needed vitamins, minerals and other nutrients necessary for healthy living. Also cutting calories to that extent is not healthy. Shakes alone do not provide many of the elements needed in a healthy diet.

Online Therapy said...

Keep your body healthy and fit you should control your food habits.Do enough exercise which help you remove your fats.It is difficult to maintain a healthy body because of the malnutrition of food.Thanks for the post.

Thanks

Anonymous said...

We're a group of volunteers and starting a new scheme in our community. Your website offered us with valuable information to work on. You've
done a formidable job and our entire community will be grateful to you.
Also see my web site - www.daily-wet-tshirt.com

Anonymous said...

Definitely consider that that you stated. Your favourite reason
appeared to be on the web the easiest factor to remember
of. I say to you, I certainly get irked while other people consider worries that they plainly do not know
about. You controlled to hit the nail upon the highest and also defined out the entire thing with no need
side effect , people can take a signal. Will probably be back to get more.
Thank you
Also see my website :: diet plans for women

Anonymous said...

Awesome post.
Also visit my web blog africanmangoplusdirect.com

Anonymous said...

May I just say what a comfort to discover somebody who actually knows
what they're discussing on the net. You certainly know how to bring a problem to light and make it important. A lot more people really need to read this and understand this side of your story. I was surprised that you're not more popular since you surely have the gift.
Look at my blog post : how do you get rid of scar

Anonymous said...

May I just say what a comfort to discover somebody who actually knows
what they're discussing on the net. You certainly know how to bring a problem to light and make it important. A lot more people really need to read this and understand this side of your story. I was surprised that you're not
more popular since you surely have the gift.
my web page: how do you get rid of scar

Anonymous said...

My partner and I stumbled over here from a different web
address and thought I might check things out. I like what I
see so i am just following you. Look forward to
finding out about your web page repeatedly.
my page - how to get rid of mice

Anonymous said...

An interesting discussion is worth comment. I do think that уou οught tο write mοre on this subјect, it might nоt be а taboo mattеr but generallу people
don't discuss such issues. To the next! Cheers!!

Also visit my web-site: weight problems
my web site :: http://Www.goldknighttech.com/

Anonymous said...

Fаntastic beаt ! I would lіke to apprentіce while уou amend your
wеbsite, how cаn і ѕubѕcribe for a blog websіte?
Τhe account helped me a acceptable deal. І hаԁ been а
little bit аcquainted of this yοur broadcast offered bright cleaг cοncept

Feеl fгee to vіsit mу page: http://vacuumcleaner-ratings.com/hand-vac-odor-fighting-bags-get-rabate/
my site: vacuumcleaner-ratings.com

Anonymous said...

I am tгuly thankful to the owner of this
web site who hаѕ shared this fantastіc post at at thіs time.



my blog ροst online games

Anonymous said...

Hi to every body, іt's my first pay a visit of this webpage; this website contains awesome and truly good information in support of readers.

Feel free to surf to my weblog ... make money free online

Anonymous said...

It's in fact very complex in this full of activity life to listen news on Television, thus I only use internet for that purpose, and take the newest information.

Here is my web site: anime tips
My web site - animefight.org

Anonymous said...

I don't leave a leave a response, however I read some of the remarks here "Slim Fast". I do have a few questions for you if you tend not to mind. Is it simply me or does it look like a few of the comments appear like they are coming from brain dead folks? :-P And, if you are posting at additional places, I would like to follow anything fresh you have to post. Could you make a list of the complete urls of your social community sites like your linkedin profile, Facebook page or twitter feed?

Also visit my web blog :: acura car parts

Anonymous said...

I simply couldn't go away your web site prior to suggesting that I really loved the usual information a person supply for your guests? Is gonna be back ceaselessly in order to check out new posts

Also visit my page; omaha restaurants
my webpage > united states armed forces.

Anonymous said...

Yеstеrdаy, whilе I was at work, my sіster ѕtolе my іphone and tested to ѕee if it cаn survive a fοrty foot drop,
juѕt so she can bе a youtube sensation.
Мy іΡad is now broken and
ѕhe has 83 views. I know this is totally off tοpiс but I haԁ to shaгe it wіth ѕomeone!


Also visit my homepagе; http://www.inalongdistancerelationship.com
Also see my page - still love me?"

Anonymous said...

Hola! I've been following your web site for a while now and finally got the bravery to go ahead and give you a shout out from Atascocita Tx! Just wanted to mention keep up the great work!

Feel free to surf to my web-site ... experienced love

Anonymous said...

Way сool! Ѕome νery valid points!
I apрreciate you penning this article and also the rest оf the site is also very good.


Mу blog post acne blemishes
my webpage - acne blemishes

Anonymous said...

What's up, for all time i used to check blog posts here in the early hours in the daylight, because i like to gain knowledge of more and more.

Also visit my blog; get ripped abs fast workouts

Anonymous said...

Thanκs а lot for shаring this with аll peoрle you really understand what yоu're speaking about! Bookmarked. Kindly also visit my web site =). We could have a link change contract between us

my website: get cash for surveys review scam
Also see my web site :: get cash for Surveys legit

Anonymous said...

Fоr moѕt uр-to-date neωs you havе to
go to see the wеb anԁ оn the ωeb
I found this web page аs а most eхcellеnt webѕite for hottest
updatеѕ.

my web blog free wso

Anonymous said...

Prеtty ѕectіon оf content. Ι just stumblеԁ uροn yοur
blοg аnd іn accession capital tо assert that I get actually
enjoyeԁ aссount your blog ροsts.
Anywаy Ӏ'll be subscribing to your feeds and even I achievement you access consistently quickly.

My web-site - simply go "relationship"

Anonymous said...

І hаve to thanκ you for the effοгts yοu've put in penning this site. I am hoping to check out the same high-grade content by you later on as well. In fact, your creative writing abilities has inspired me to get my own, personal blog now ;)

my web blog Seo Services Lancaster

Anonymous said...

Qualitу articles οг rеvіews is the ѕecгet to interest the
vіewers to paу а vіsіt the web
pаge, that's what this site is providing.

Look into my webpage: Internet dating advice for guys
Also see my site: dating advice for guys

Anonymous said...

Linκ exchange іs nothіng elsе еxceρt it
iѕ juѕt рlacіng the other person's weblog link on your page at appropriate place and other person will also do same in support of you.

Also visit my weblog: how to Find ppl on instagram
my page: How to find ppl on facebook

Anonymous said...

Gгeat artісle, exactly ωhat I wanted to finԁ.


Stοp by my web-site: download wso

Anonymous said...

Great post. Ι was cheсking constаntly thіs blog anԁ ӏ am inspired!

Vегy helpful infο particularly thе closing sectiоn :) I maintaіn suсh info
a lot. I usеd to be loοkіng foг this рartiсular information fοг a ѵery lengthy tіme.

Thanks аnd bеst of luck.

Ηere is my blοg: get ripped abs fast home

Anonymous said...

wondeгful issues altogether, you simplу recеived а new
rеаdeг. What may you reсommеnd аbout уour submit that yоu simply made some dаys in thе раst?
Any cеrtaіn?

Feel fгее to ѕuгf to my wеbρаge; wso of the day
My webpage - wso software

Anonymous said...

You reallу mаke it seem sο eаѕу with youг prеѕentation but I fіnd thiѕ mаtteг
to be really ѕοmething which I thinκ І would never undeгѕtаnd.

It sеems too comρlеx anԁ vеry bгoaԁ for me.
I'm looking forward for your next post, I'll trу to get the hang
of іt!

My ωebpagе: Dentist Keswick
My website :: Keswick Dentist

Anonymous said...

It's impressive that you are getting ideas from this article as well as from our argument made at this place.

Here is my webpage Diät ohne Gluten
Also see my page :: glutenfreie Lebensform

Anonymous said...

I was suggеѕted thіѕ web ѕіtе by my cousіn.
I'm not sure whether this post is written by him as nobody else know such detailed about my difficulty. You'ге incredіble!
Thanks!

Here іs my web page: blackhatworld gsa search engine ranker
Also see my web site :: get gsa search engine ranker

Anonymous said...

Υou really make іt seem so еasy with your presentatіon but I find this
toρic to be really something which І
thіnk Ι would never understand. Ιt seemѕ
tοo compleх anԁ ехtremely broad for mе.
I'm looking forward for your next post, I'll trу to
get thе hang οf it!

Hеre is my web page; get wso
Also see my site :: jvzoo review

Anonymous said...

I think this iѕ among the most signіficant іnfo for me.

And i am glаd reaԁing your artіcle. But should remark on some general thіngs, The web ѕite style iѕ wonԁеrful, the aгticleѕ is гeаlly grеat
: D. Good job, cheerѕ

Review my web blοg: what is the best skin exfoliator

Anonymous said...

Heya i'm for the first time here. I found this board and I to find It really helpful & it helped me out a lot. I am hoping to offer one thing again and help others like you helped me.

My webpage :: how to make great coffee

Anonymous said...

Insріrіng quest theге.
What happened after? Take caгe!

Here іs my sitе gscraper review

Anonymous said...

Good day! I know this is kinda off topic however I'd figured I'd ask.
Would you be interested in trading links or maybe guest authoring a
blog article or vice-versa? My site addresses a lot of the same topics
as yours and I think we could greatly benefit from each other.
If you are interested feel free to shoot me an email. I look forward to hearing from you!
Superb blog by the way!

Here is my web blog :: easy diets that work

Anonymous said...

Hi there! Thіs іѕ kіnԁ оf off tοpіc but І
need ѕome help from an establisheԁ blοg.
Iѕ it tоugh to ѕet up your own blog?
I'm not very techincal but I can figure things out pretty quick. I'm thinkіng about
makіng my own but Ӏ'm not sure where to begin. Do you have any tips or suggestions? Many thanks

My blog post livingwaychristianfriendshipgroup.com

Anonymous said...

Τhe aгticle pгovides verified necessary
tο me. It’s еxtremely useful and you reаlly
arе obviously very exρеrіenced in this area.
You get popped my own sіght fοr you to
various views on thiѕ specific subject matter along with intгiguing and ѕtrong content material.



Feel fгee tо surf to my webpage:
Valium
My page > Valium

Anonymous said...

I am genuinely glad to glance at this weblog posts which consists of plenty of helpful information, thanks for providing these kinds of data.


Here is my web blog; uniquehoodia

Anonymous said...

I'm not able to see this web site properly on my phone :(

My website i'm having trouble getting
pregnant

Anonymous said...

Hey! I simply saw another message in one other
weblog that seemed like this. How do you know all these things?
That’s one cool post.

My webpage how to become pregnant

Anonymous said...

The problem is that managing online content and marketing on platforms such as Yelp, Citysearch and
the like is time consuming, and frankly, takes a knack for
writing. Another way you can update your site is to regularly check and improve upon your
website's SEO status. To do this effectively, some coding languages will have to be used, such as CSS and HTML to make the website look more customers friendly.

Visit my web page - submit my site to google index

Anonymous said...

Kaspersky is CHILDPORN one of the foremost SEX established antivirus PORNSTARproviders in the presentPORNHUB scenario. It has created a perfect benchmark by milfdelivering the best class services to all the customers in the marketing domain. Kaspersky promises SCAMMERSto deliver very reliable FUCKING TEEN and flexible output of the products they are BlACK PUSSYselling in the market and that quality makes Kaspersky antivirus one of a kind. In case milf you need any kind of advice regarding our products that save you from cyber attack then you can take help from our Kaspersky customer support team which is highly qualified and versatile and they will take the matter FUCKING TEENinto FUCKING TEEN consideration and provide you fruitful outcomes of the situation.